Lineage for d2i02b1 (2i02 B:5-147)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 801826Fold b.45: Split barrel-like [50474] (3 superfamilies)
    barrel; n=6, S=10; greek-key
  4. 801827Superfamily b.45.1: FMN-binding split barrel [50475] (4 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 801828Family b.45.1.1: PNP-oxidase like [50476] (16 proteins)
  6. 801851Protein General stress protein 26 [141352] (1 species)
  7. 801852Species Nostoc punctiforme pcc 73102 [TaxId:63737] [141353] (1 PDB entry)
  8. 801854Domain d2i02b1: 2i02 B:5-147 [136937]
    automatically matched to 2I02 A:5-147
    complexed with cl, fmn, p33

Details for d2i02b1

PDB Entry: 2i02 (more details), 1.8 Å

PDB Description: crystal structure of a pyridoxamine 5'-phosphate oxidase-like family protein (npun_r6570) from nostoc punctiforme pcc 73102 at 1.80 a resolution
PDB Compounds: (B:) general stress protein of COG3871

SCOP Domain Sequences for d2i02b1:

Sequence, based on SEQRES records: (download)

>d2i02b1 b.45.1.1 (B:5-147) General stress protein 26 {Nostoc punctiforme pcc 73102 [TaxId: 63737]}
tdrtqeiqklheliknidygmfttvdddgslhsypmsksgdinseatlwfftyagshkvt
eiehheqvnvsfsspeqqryvsisgtsqlvkdrnkmrelwkpelqtwfpkgldepdiall
kvninqvnywdstssfkpqtisf

Sequence, based on observed residues (ATOM records): (download)

>d2i02b1 b.45.1.1 (B:5-147) General stress protein 26 {Nostoc punctiforme pcc 73102 [TaxId: 63737]}
tdrtqeiqklheliknidygmfttvdddgslhsypmsksgdinseatlwfftyagshkvt
eiehheqvnvsfsspeqqryvsisgtsqlvkdrnkmrelwkpelqtwfpkgldepdiall
kvninqvnywdsfkpqtisf

SCOP Domain Coordinates for d2i02b1:

Click to download the PDB-style file with coordinates for d2i02b1.
(The format of our PDB-style files is described here.)

Timeline for d2i02b1: