Lineage for d2i02a1 (2i02 A:5-147)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2403705Fold b.45: Split barrel-like [50474] (3 superfamilies)
    barrel; n=6, S=10; greek-key
  4. 2403706Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 2403707Family b.45.1.1: PNP-oxidase like [50476] (17 proteins)
  6. 2403741Protein General stress protein 26 [141352] (1 species)
  7. 2403742Species Nostoc punctiforme pcc 73102 [TaxId:63737] [141353] (1 PDB entry)
  8. 2403743Domain d2i02a1: 2i02 A:5-147 [136936]
    complexed with cl, fmn, p33

Details for d2i02a1

PDB Entry: 2i02 (more details), 1.8 Å

PDB Description: crystal structure of a pyridoxamine 5'-phosphate oxidase-like family protein (npun_r6570) from nostoc punctiforme pcc 73102 at 1.80 a resolution
PDB Compounds: (A:) general stress protein of COG3871

SCOPe Domain Sequences for d2i02a1:

Sequence, based on SEQRES records: (download)

>d2i02a1 b.45.1.1 (A:5-147) General stress protein 26 {Nostoc punctiforme pcc 73102 [TaxId: 63737]}
tdrtqeiqklheliknidygmfttvdddgslhsypmsksgdinseatlwfftyagshkvt
eiehheqvnvsfsspeqqryvsisgtsqlvkdrnkmrelwkpelqtwfpkgldepdiall
kvninqvnywdstssfkpqtisf

Sequence, based on observed residues (ATOM records): (download)

>d2i02a1 b.45.1.1 (A:5-147) General stress protein 26 {Nostoc punctiforme pcc 73102 [TaxId: 63737]}
tdrtqeiqklheliknidygmfttvdddgslhsypmsksgdeatlwfftyagshkvteie
hheqvnvsfsspeqqryvsisgtsqlvkdrnkmrelwkpelqtwfpkgldepdiallkvn
inqvnywdstssfkpqtisf

SCOPe Domain Coordinates for d2i02a1:

Click to download the PDB-style file with coordinates for d2i02a1.
(The format of our PDB-style files is described here.)

Timeline for d2i02a1: