SCOP 1.73: Domain d2hzyb2: 2hzy B:119-416

Lineage for d2hzyb2 (2hzy B:119-416)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.177: FAH [56528] (1 superfamily)
   unusual fold; contains 3 layers of beta-sheet structure

4. Superfamily d.177.1: FAH [56529] (1 family)

5. Family d.177.1.1: FAH [56530] (6 proteins)

6. Protein Fumarylacetoacetate hydrolase, FAH, C-terminal domain [63432] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [56532] (5 PDB entries)

8. Domain d2hzyb2: 2hzy B:119-416 [136935]
   Other proteins in same PDB: d2hzya1, d2hzyb1
   automatically matched to d1qcnb2
   complexed with ca, dhj, mn, na, ni

Details for d2hzyb2

PDB Entry: 2hzy, 1.35 Å

PDB Description: Mouse fumarylacetoacetate hydrolase complexes with a transition-state mimic of the complete substrate

PDB Compounds: (B:) Fumarylacetoacetase

SCOP Domain Sequences for d2hzyb2:

Sequence; same for both SEQRES and ATOM records:

>d2hzyb2 d.177.1.1 (B:119-416) Fumarylacetoacetate hydrolase, FAH, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
atigdytdfyssrqhatnvgimfrgkenallpnwlhlpvgyhgrassivvsgtpirrpmg
qmrpdnskppvygacrlldmelemaffvgpgnrfgepipiskahehifgmvlmndwsard
iqqweyvplgpflgksfgttispwvvpmdalmpfvvpnpkqdpkplpylchsqpytfdin
lsvslkgegmsqaaticrsnfkhmywtmlqqlthhsvngcnlrpgdllasgtisgsdpes
fgsmlelswkgtkaidvgqgqtrtflldgdeviitghcqgdgyrvgfgqcagkvlpal

Timeline for d2hzyb2:

• d2hzyb2 is new in SCOP 1.73
  
• d2hzyb2 appears in SCOP 1.75
  
• d2hzyb2 appears in the current release, SCOPe 2.08