SCOPe 2.08: Domain d2hzyb1: 2hzy B:1-118

Lineage for d2hzyb1 (2hzy B:1-118)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.8: Fumarylacetoacetate hydrolase, FAH, N-terminal domain [63433] (2 families)
   automatically mapped to Pfam PF09298

5. Family b.34.8.1: Fumarylacetoacetate hydrolase, FAH, N-terminal domain [63434] (1 protein)
   contains 5 short helices in the loop between the third and fourth strands

6. Protein Fumarylacetoacetate hydrolase, FAH, N-terminal domain [63435] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [63436] (5 PDB entries)

8. Domain d2hzyb1: 2hzy B:1-118 [136934]
   Other proteins in same PDB: d2hzya2, d2hzyb2, d2hzyb3
   automated match to d1hyob1
   complexed with ca, dhj, mn, na, ni

Details for d2hzyb1

PDB Entry: 2hzy, 1.35 Å

PDB Description: Mouse fumarylacetoacetate hydrolase complexes with a transition-state mimic of the complete substrate

PDB Compounds: (B:) Fumarylacetoacetase

SCOPe Domain Sequences for d2hzyb1:

Sequence; same for both SEQRES and ATOM records:

>d2hzyb1 b.34.8.1 (B:1-118) Fumarylacetoacetate hydrolase, FAH, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
msfipvaedsdfpiqnlpygvfstqsnpkprigvaigdqildlsvikhlftgpalskhqh
vfdettlnnfmglgqaawkearaslqnllsasqarlrddkelrqraftsqasatmhlp

Timeline for d2hzyb1:

• d2hzyb1 first appeared in SCOP 1.73
  
• d2hzyb1 appears in SCOPe 2.07