Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.18: ACT-like [55021] (15 families) regulatory domain linked to a wide range of metabolic enzymes |
Family d.58.18.4: Nickel responsive regulator NikR, C-terminal domain [102999] (2 proteins) automatically mapped to Pfam PF08753 |
Protein Nickel responsive regulator NikR, C-terminal domain [103000] (2 species) |
Species Escherichia coli [TaxId:562] [103001] (8 PDB entries) |
Domain d2hzvf2: 2hzv F:49-131 [136927] Other proteins in same PDB: d2hzva1, d2hzvb1, d2hzvc1, d2hzvd1, d2hzve1, d2hzvf1, d2hzvg1, d2hzvh1 automated match to d1q5va2 protein/DNA complex; complexed with k, ni |
PDB Entry: 2hzv (more details), 3.1 Å
SCOPe Domain Sequences for d2hzvf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hzvf2 d.58.18.4 (F:49-131) Nickel responsive regulator NikR, C-terminal domain {Escherichia coli [TaxId: 562]} gtqgfavlsyvyehekrdlasrivstqhhhhdlsvatlhvhinhddcleiavlkgdmgdv qhfaddviaqrgvrhghlqclpk
Timeline for d2hzvf2: