| Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
| Fold d.58: Ferredoxin-like [54861] (55 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.18: ACT-like [55021] (12 families) ![]() regulatory domain linked to a wide range of metabolic enzymes |
| Family d.58.18.4: Nickel responsive regulator NikR, C-terminal domain [102999] (1 protein) |
| Protein Nickel responsive regulator NikR, C-terminal domain [103000] (2 species) |
| Species Escherichia coli [TaxId:562] [103001] (4 PDB entries) |
| Domain d2hzvd2: 2hzv D:49-131 [136923] Other proteins in same PDB: d2hzva1, d2hzvb1, d2hzvc1, d2hzvd1, d2hzve1, d2hzvf1, d2hzvg1, d2hzvh1 automatically matched to d1q5vb2 complexed with k, ni |
PDB Entry: 2hzv (more details), 3.1 Å
SCOP Domain Sequences for d2hzvd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hzvd2 d.58.18.4 (D:49-131) Nickel responsive regulator NikR, C-terminal domain {Escherichia coli [TaxId: 562]}
gtqgfavlsyvyehekrdlasrivstqhhhhdlsvatlhvhinhddcleiavlkgdmgdv
qhfaddviaqrgvrhghlqclpk
Timeline for d2hzvd2: