Lineage for d2hzvd2 (2hzv D:49-131)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 725281Superfamily d.58.18: ACT-like [55021] (12 families) (S)
    regulatory domain linked to a wide range of metabolic enzymes
  5. 725317Family d.58.18.4: Nickel responsive regulator NikR, C-terminal domain [102999] (1 protein)
  6. 725318Protein Nickel responsive regulator NikR, C-terminal domain [103000] (2 species)
  7. 725332Species Escherichia coli [TaxId:562] [103001] (4 PDB entries)
  8. 725346Domain d2hzvd2: 2hzv D:49-131 [136923]
    Other proteins in same PDB: d2hzva1, d2hzvb1, d2hzvc1, d2hzvd1, d2hzve1, d2hzvf1, d2hzvg1, d2hzvh1
    automatically matched to d1q5vb2
    complexed with k, ni

Details for d2hzvd2

PDB Entry: 2hzv (more details), 3.1 Å

PDB Description: NikR-operator DNA complex
PDB Compounds: (D:) Nickel-responsive regulator

SCOP Domain Sequences for d2hzvd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hzvd2 d.58.18.4 (D:49-131) Nickel responsive regulator NikR, C-terminal domain {Escherichia coli [TaxId: 562]}
gtqgfavlsyvyehekrdlasrivstqhhhhdlsvatlhvhinhddcleiavlkgdmgdv
qhfaddviaqrgvrhghlqclpk

SCOP Domain Coordinates for d2hzvd2:

Click to download the PDB-style file with coordinates for d2hzvd2.
(The format of our PDB-style files is described here.)

Timeline for d2hzvd2: