Lineage for d2hzvc2 (2hzv C:49-131)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2954059Superfamily d.58.18: ACT-like [55021] (15 families) (S)
    regulatory domain linked to a wide range of metabolic enzymes
  5. 2954103Family d.58.18.4: Nickel responsive regulator NikR, C-terminal domain [102999] (2 proteins)
    automatically mapped to Pfam PF08753
  6. 2954104Protein Nickel responsive regulator NikR, C-terminal domain [103000] (2 species)
  7. 2954105Species Escherichia coli [TaxId:562] [103001] (8 PDB entries)
  8. 2954129Domain d2hzvc2: 2hzv C:49-131 [136921]
    Other proteins in same PDB: d2hzva1, d2hzvb1, d2hzvc1, d2hzvd1, d2hzve1, d2hzvf1, d2hzvg1, d2hzvh1
    automated match to d1q5va2
    protein/DNA complex; complexed with k, ni

Details for d2hzvc2

PDB Entry: 2hzv (more details), 3.1 Å

PDB Description: NikR-operator DNA complex
PDB Compounds: (C:) Nickel-responsive regulator

SCOPe Domain Sequences for d2hzvc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hzvc2 d.58.18.4 (C:49-131) Nickel responsive regulator NikR, C-terminal domain {Escherichia coli [TaxId: 562]}
gtqgfavlsyvyehekrdlasrivstqhhhhdlsvatlhvhinhddcleiavlkgdmgdv
qhfaddviaqrgvrhghlqclpk

SCOPe Domain Coordinates for d2hzvc2:

Click to download the PDB-style file with coordinates for d2hzvc2.
(The format of our PDB-style files is described here.)

Timeline for d2hzvc2: