SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2hzvb2 (2hzv B:49-131)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2172288Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2176307Superfamily d.58.18: ACT-like [55021] (15 families) (S)
    regulatory domain linked to a wide range of metabolic enzymes
  5. 2176351Family d.58.18.4: Nickel responsive regulator NikR, C-terminal domain [102999] (2 protein domains)
    automatically mapped to Pfam PF08753
  6. 2176352Protein Nickel responsive regulator NikR, C-terminal domain [103000] (2 species)
  7. 2176353Species Escherichia coli [TaxId:562] [103001] (8 PDB entries)
  8. 2176376Domain d2hzvb2: 2hzv B:49-131 [136919]
    Other proteins in same PDB: d2hzva1, d2hzvb1, d2hzvc1, d2hzvd1, d2hzve1, d2hzvf1, d2hzvg1, d2hzvh1
    automated match to d1q5va2
    protein/DNA complex; complexed with k, ni

Details for d2hzvb2

PDB Entry: 2hzv (more details), 3.1 Å

PDB Description: NikR-operator DNA complex
PDB Compounds: (B:) Nickel-responsive regulator

SCOPe Domain Sequences for d2hzvb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hzvb2 d.58.18.4 (B:49-131) Nickel responsive regulator NikR, C-terminal domain {Escherichia coli [TaxId: 562]}
gtqgfavlsyvyehekrdlasrivstqhhhhdlsvatlhvhinhddcleiavlkgdmgdv
qhfaddviaqrgvrhghlqclpk

SCOPe Domain Coordinates for d2hzvb2:

Click to download the PDB-style file with coordinates for d2hzvb2.
(The format of our PDB-style files is described here.)

Timeline for d2hzvb2: