SCOPe 2.08: Domain d2hzva2: 2hzv A:49-131

Lineage for d2hzva2 (2hzv A:49-131)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.18: ACT-like [55021] (15 families)
   regulatory domain linked to a wide range of metabolic enzymes

5. Family d.58.18.4: Nickel responsive regulator NikR, C-terminal domain [102999] (2 proteins)
   automatically mapped to Pfam PF08753

6. Protein Nickel responsive regulator NikR, C-terminal domain [103000] (2 species)

7. Species Escherichia coli [TaxId:562] [103001] (8 PDB entries)

8. Domain d2hzva2: 2hzv A:49-131 [136917]
   Other proteins in same PDB: d2hzva1, d2hzvb1, d2hzvc1, d2hzvd1, d2hzve1, d2hzvf1, d2hzvg1, d2hzvh1
   automated match to d1q5va2
   protein/DNA complex; complexed with k, ni

Details for d2hzva2

PDB Entry: 2hzv, 3.1 Å

PDB Description: NikR-operator DNA complex

PDB Compounds: (A:) Nickel-responsive regulator

SCOPe Domain Sequences for d2hzva2:

Sequence; same for both SEQRES and ATOM records:

>d2hzva2 d.58.18.4 (A:49-131) Nickel responsive regulator NikR, C-terminal domain {Escherichia coli [TaxId: 562]}
gtqgfavlsyvyehekrdlasrivstqhhhhdlsvatlhvhinhddcleiavlkgdmgdv
qhfaddviaqrgvrhghlqclpk

Timeline for d2hzva2:

• d2hzva2 first appeared in SCOP 1.73
  
• d2hzva2 appears in SCOPe 2.07