Lineage for d2hzbd_ (2hzb D:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1886469Fold c.143: CofD-like [142337] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 3214567; topological similarity to the CobT-like fold (52732)
  4. 1886470Superfamily c.143.1: CofD-like [142338] (2 families) (S)
  5. 1886471Family c.143.1.1: CofD-like [142339] (3 proteins)
    Pfam PF01933; UPF0052
  6. 1886472Protein Hypothetical protein BH3568 [142342] (1 species)
  7. 1886473Species Bacillus halodurans [TaxId:86665] [142343] (1 PDB entry)
    Uniprot Q9K706 2-312
  8. 1886477Domain d2hzbd_: 2hzb D: [136914]
    automated match to d2hzba1

Details for d2hzbd_

PDB Entry: 2hzb (more details), 2.8 Å

PDB Description: x-ray crystal structure of protein bh3568 from bacillus halodurans. northeast structural genomics consortium bhr60.
PDB Compounds: (D:) Hypothetical UPF0052 protein BH3568

SCOPe Domain Sequences for d2hzbd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hzbd_ c.143.1.1 (D:) Hypothetical protein BH3568 {Bacillus halodurans [TaxId: 86665]}
kkknvvvfgggtglsvllrglktfpvsitaivtvaddggssgrlrkeldipppgdvrnvl
valseveplleqlfqhrfengnglsghslgnlllagmtsitgdfargisemskvlnvrgk
vlpasnrsiilhgemedgtivtgessipkagkkikrvfltpkdtkplregleairkadvi
vigpgslytsvlpnllvpgiceaikqstarkvyicnvmtqngetdgytasdhlqaimdhc
gvgivddilvhgepisdtvkakyakekaepvivdehklkalgvgtisdyfvleqddvlrh
naskvseaile

SCOPe Domain Coordinates for d2hzbd_:

Click to download the PDB-style file with coordinates for d2hzbd_.
(The format of our PDB-style files is described here.)

Timeline for d2hzbd_: