![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.18: ACT-like [55021] (15 families) ![]() regulatory domain linked to a wide range of metabolic enzymes |
![]() | Family d.58.18.4: Nickel responsive regulator NikR, C-terminal domain [102999] (2 proteins) automatically mapped to Pfam PF08753 |
![]() | Protein Nickel responsive regulator NikR, C-terminal domain [103000] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [103001] (8 PDB entries) |
![]() | Domain d2hzab2: 2hza B:49-131 [136910] Other proteins in same PDB: d2hzaa1, d2hzab1 automated match to d1q5va2 complexed with 3cm, ni |
PDB Entry: 2hza (more details), 2.1 Å
SCOPe Domain Sequences for d2hzab2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hzab2 d.58.18.4 (B:49-131) Nickel responsive regulator NikR, C-terminal domain {Escherichia coli [TaxId: 562]} gtqgfavlsyvyehekrdlasrivstqhhhhdlsvatlhvhinhddcleiavlkgdmgdv qhfaddviaqrgvrhghlqclpk
Timeline for d2hzab2: