Lineage for d2hz1a1 (2hz1 A:2-124)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 631651Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 631652Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 631653Family a.1.1.1: Truncated hemoglobin [46459] (1 protein)
    lack the first helix (A)
  6. 631654Protein Protozoan/bacterial hemoglobin [46460] (6 species)
  7. 631660Species Cyanobacteria (Synechocystis sp.), pcc 6803 [TaxId:1148] [81667] (5 PDB entries)
  8. 631663Domain d2hz1a1: 2hz1 A:2-124 [136906]
    automatically matched to d1mwba_
    complexed with cd, hem, so2, so3

Details for d2hz1a1

PDB Entry: 2hz1 (more details), 1.8 Å

PDB Description: The x-ray crystal structure of ferrous Synechocystis hemoglobin with a covalent linkage
PDB Compounds: (A:) Cyanoglobin

SCOP Domain Sequences for d2hz1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hz1a1 a.1.1.1 (A:2-124) Protozoan/bacterial hemoglobin {Cyanobacteria (Synechocystis sp.), pcc 6803 [TaxId: 1143]}
stlyeklggttavdlavdkfyervlqddrikhffadvdmakqrahqkafltyafggtdky
dgrymreahkelvenhglngehfdavaedllatlkemgvpedliaevaavagapahkrdv
lnq

SCOP Domain Coordinates for d2hz1a1:

Click to download the PDB-style file with coordinates for d2hz1a1.
(The format of our PDB-style files is described here.)

Timeline for d2hz1a1: