Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)
Search SCOP (example):

Lineage for d2hz1a_ (2hz1 A:)

  1. Root: SCOP 1.75B
  2. Class a: All alpha proteins [46456] (284 folds)
  3. Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. Family a.1.1.1: Truncated hemoglobin [46459] (2 protein domains)
    lack the first helix (A)
  6. Protein Protozoan/bacterial hemoglobin [46460] (6 species)
  7. Species Synechocystis sp. PCC 6803 [TaxId:1148] [81667] (7 PDB entries)
    Uniprot P73925
  8. Domain d2hz1a_: 2hz1 A: [136906]
    automated match to d1mwba_
    complexed with cd, hem, so2, so3

Details for d2hz1a_

PDB Entry: 2hz1 (more details)
PDB Description: the x-ray crystal structure of ferrous synechocystis hemoglo covalent linkage
PDB Compounds: (A:) Cyanoglobin

SCOP Domain Sequences for d2hz1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hz1a_ a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Synechocystis sp. PCC 6803 [TaxId: 1148]}
stlyeklggttavdlavdkfyervlqddrikhffadvdmakqrahqkafltyafggtdky
dgrymreahkelvenhglngehfdavaedllatlkemgvpedliaevaavagapahkrdv
lnq

SCOP Domain Coordinates for d2hz1a_:

Click to download the PDB-style file with coordinates for d2hz1a_.
(The format of our PDB-style files is described here.)

Timeline for d2hz1a_:

d2hz1a_ appears in SCOP 1.75A


d2hz1a_
(click for larger image)


d2hz1a_ in context of chain

SCOP Copyright © 1994-2013 The SCOP and Astral authors
scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu