Lineage for d2hysa2 (2hys A:1-179)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. Protein Nitrophorin 2 (prolixin-s) [50843] (1 species)
  7. Species Rhodnius prolixus [TaxId:13249] [50844] (14 PDB entries)
    Uniprot Q26241
  8. Domain d2hysa2: 2hys A:1-179 [136905]
    Other proteins in same PDB: d2hysa3
    automated match to d1euoa_
    complexed with cyn, hem

Details for d2hysa2

PDB Entry: 2hys (more details), 1.2 Å

PDB Description: Crystal structure of nitrophorin 2 complexed with cyanide
PDB Compounds: (A:) Nitrophorin-2

SCOPe Domain Sequences for d2hysa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hysa2 b.60.1.1 (A:1-179) Nitrophorin 2 (prolixin-s) {Rhodnius prolixus [TaxId: 13249]}
dcstnispkqgldkakyfsgkwyvthfldkdpqvtdqycssftpresdgtvkealyhyna
nkktsfynigegklessglqytakyktvdkkkavlkeadeknsytltvleaddssalvhi
clregskdlgdlytvlthqkdaepsakvksavtqaglqlsqfvgtkdlgcqyddqftsl

SCOPe Domain Coordinates for d2hysa2 are not available.

Timeline for d2hysa2:

Domains from same chain:
(mouse over for more information)
d2hysa3