Class b: All beta proteins [48724] (165 folds) |
Fold b.77: beta-Prism I [51091] (3 superfamilies) consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis duplication: has internal pseudo threefold symmetry |
Superfamily b.77.3: Mannose-binding lectins [51101] (1 family) |
Family b.77.3.1: Mannose-binding lectins [51102] (6 proteins) |
Protein Griffithsin [141569] (1 species) single-chain subunits form a segment-swapped dimer |
Species Red alga (Griffithsia) [TaxId:35158] [141570] (7 PDB entries) |
Domain d2hyrb1: 2hyr B:1-121 [136904] automatically matched to 2GTY A:1-121 complexed with ace, edo, glc, mg, so4 |
PDB Entry: 2hyr (more details), 1.51 Å
SCOP Domain Sequences for d2hyrb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hyrb1 b.77.3.1 (B:1-121) Griffithsin {Red alga (Griffithsia) [TaxId: 35158]} slthrkfggsggspfsglssiavrsgsyldaiiidgvhhggsggnlsptftfgsgeyisn mtirsgdyidnisfetnmgrrfgpyggsggsantlsnvkviqingsagdyldsldiyyeq y
Timeline for d2hyrb1: