Lineage for d2hyrb1 (2hyr B:1-121)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2813105Fold b.77: beta-Prism I [51091] (4 superfamilies)
    consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
    duplication: has internal pseudo threefold symmetry
  4. 2813155Superfamily b.77.3: Mannose-binding lectins [51101] (2 families) (S)
  5. 2813156Family b.77.3.1: Mannose-binding lectins [51102] (7 proteins)
  6. 2813197Protein Griffithsin [141569] (2 species)
    single-chain subunits form a segment-swapped dimer
  7. 2813201Species Red alga (Griffithsia) [TaxId:35158] [141570] (7 PDB entries)
    Uniprot P84801 1-121
  8. 2813207Domain d2hyrb1: 2hyr B:1-121 [136904]
    automatically matched to 2GTY A:1-121
    complexed with edo, mg, so4

Details for d2hyrb1

PDB Entry: 2hyr (more details), 1.51 Å

PDB Description: crystal structure of a complex of griffithsin with maltose
PDB Compounds: (B:) Griffithsin

SCOPe Domain Sequences for d2hyrb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hyrb1 b.77.3.1 (B:1-121) Griffithsin {Red alga (Griffithsia) [TaxId: 35158]}
slthrkfggsggspfsglssiavrsgsyldaiiidgvhhggsggnlsptftfgsgeyisn
mtirsgdyidnisfetnmgrrfgpyggsggsantlsnvkviqingsagdyldsldiyyeq
y

SCOPe Domain Coordinates for d2hyrb1:

Click to download the PDB-style file with coordinates for d2hyrb1.
(The format of our PDB-style files is described here.)

Timeline for d2hyrb1: