SCOPe 2.08: Domain d2hyqa1: 2hyq A:1-121

Lineage for d2hyqa1 (2hyq A:1-121)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.77: beta-Prism I [51091] (4 superfamilies)
   consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.77.3: Mannose-binding lectins [51101] (2 families)

5. Family b.77.3.1: Mannose-binding lectins [51102] (7 proteins)

6. Protein Griffithsin [141569] (2 species)
   single-chain subunits form a segment-swapped dimer

7. Species Red alga (Griffithsia) [TaxId:35158] [141570] (7 PDB entries)
   Uniprot P84801 1-121

8. Domain d2hyqa1: 2hyq A:1-121 [136901]
   automatically matched to 2GTY A:1-121
   complexed with so4

Details for d2hyqa1

PDB Entry: 2hyq, 2 Å

PDB Description: crystal structure of a complex of griffithsin with 6alpha-mannobiose

PDB Compounds: (A:) Griffithsin

SCOPe Domain Sequences for d2hyqa1:

Sequence; same for both SEQRES and ATOM records:

>d2hyqa1 b.77.3.1 (A:1-121) Griffithsin {Red alga (Griffithsia) [TaxId: 35158]}
slthrkfggsggspfsglssiavrsgsyldaiiidgvhhggsggnlsptftfgsgeyisn
mtirsgdyidnisfetnmgrrfgpyggsggsantlsnvkviqingsagdyldsldiyyeq
y

Timeline for d2hyqa1:

• d2hyqa1 first appeared in SCOP 1.73
  
• d2hyqa1 appears in SCOPe 2.07