SCOPe 2.08: Domain d2hymb_: 2hym B:

Lineage for d2hymb_ (2hym B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (9 proteins)
   contains an additional helix in one of the crossover connections

6. Protein Interferon-alpha 2a [47314] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47315] (9 PDB entries)

8. Domain d2hymb_: 2hym B: [136900]
   Other proteins in same PDB: d2hyma1, d2hyma2
   automated match to d1itfa_

Details for d2hymb_

PDB Entry: 2hym

PDB Description: nmr based docking model of the complex between the human type i interferon receptor and human interferon alpha-2

PDB Compounds: (B:) Interferon alpha-2

SCOPe Domain Sequences for d2hymb_:

Sequence; same for both SEQRES and ATOM records:

>d2hymb_ a.26.1.3 (B:) Interferon-alpha 2a {Human (Homo sapiens) [TaxId: 9606]}
cdlpqthslgsrrtlmllaqmrkislfsclkdrhdfgfpqeefgnqfqkaetipvlhemi
qqifnlfstkdssaawdetlldkfytelyqqlndleacviqgvgvtetplmkedsilavr
kyfqritlylkekkyspcawevvraeimrsfslstnlqeslrske

Timeline for d2hymb_:

• d2hymb_ first appeared in SCOP 1.73, called d2hymb1
  
• d2hymb_ appears in SCOPe 2.07