Lineage for d2hyii2 (2hyi I:244-411)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2127512Family c.37.1.19: Tandem AAA-ATPase domain [81268] (24 proteins)
    duplication: tandem repeat of two RecA-like (AAA) domains
  6. 2127617Protein Probable ATP-dependent RNA helicase DDX48 [142314] (1 species)
    Eukaryotic translation initiation factor 4A isoform 3
  7. 2127618Species Human (Homo sapiens) [TaxId:9606] [142315] (2 PDB entries)
    Uniprot P38919 22-243! Uniprot P38919 244-411
  8. 2127622Domain d2hyii2: 2hyi I:244-411 [136897]
    Other proteins in same PDB: d2hyia_, d2hyib_, d2hyic3, d2hyig_, d2hyih_, d2hyii3
    automated match to d2hyic2
    protein/RNA complex; complexed with anp, mg

Details for d2hyii2

PDB Entry: 2hyi (more details), 2.3 Å

PDB Description: Structure of the human exon junction complex with a trapped DEAD-box helicase bound to RNA
PDB Compounds: (I:) Probable ATP-dependent RNA helicase DDX48

SCOPe Domain Sequences for d2hyii2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hyii2 c.37.1.19 (I:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]}
deltlegikqffvavereewkfdtlcdlydtltitqavifcntkrkvdwltekmreanft
vssmhgdmpqkeresimkefrsgasrvlistdvwargldvpqvsliinydlpnnrelyih
rigrsgrygrkgvainfvknddirilrdieqyystqidempmnvadli

SCOPe Domain Coordinates for d2hyii2:

Click to download the PDB-style file with coordinates for d2hyii2.
(The format of our PDB-style files is described here.)

Timeline for d2hyii2: