Lineage for d2hyih_ (2hyi H:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2195050Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 2195051Family d.58.7.1: Canonical RBD [54929] (68 proteins)
  6. 2195315Protein RNA-binding protein 8 [89938] (2 species)
  7. 2195321Species Human (Homo sapiens) [TaxId:9606] [102978] (3 PDB entries)
    RBM8A, Y14
  8. 2195325Domain d2hyih_: 2hyi H: [136895]
    Other proteins in same PDB: d2hyia_, d2hyic1, d2hyic2, d2hyic3, d2hyig_, d2hyii1, d2hyii2, d2hyii3
    automated match to d1p27b_
    protein/RNA complex; complexed with anp, mg

Details for d2hyih_

PDB Entry: 2hyi (more details), 2.3 Å

PDB Description: Structure of the human exon junction complex with a trapped DEAD-box helicase bound to RNA
PDB Compounds: (H:) RNA-binding protein 8A

SCOPe Domain Sequences for d2hyih_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hyih_ d.58.7.1 (H:) RNA-binding protein 8 {Human (Homo sapiens) [TaxId: 9606]}
pgpqrsvegwilfvtgvheeateedihdkfaeygeiknihlnldrrtgylkgytlveyet
ykeaqaameglngqdlmgqpisvdwcfvrgp

SCOPe Domain Coordinates for d2hyih_:

Click to download the PDB-style file with coordinates for d2hyih_.
(The format of our PDB-style files is described here.)

Timeline for d2hyih_: