![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily) 6 helices, homodimer of 3-helical domains |
![]() | Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (2 families) ![]() automatically mapped to Pfam PF02742 |
![]() | Family a.76.1.1: Iron-dependent repressor protein, dimerization domain [47980] (4 proteins) |
![]() | Protein Manganese transport regulator MntR [89086] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [89087] (11 PDB entries) |
![]() | Domain d2hyfd2: 2hyf D:63-138 [136887] Other proteins in same PDB: d2hyfa1, d2hyfb1, d2hyfc1, d2hyfd1 automated match to d1on1a2 complexed with epe, so4 |
PDB Entry: 2hyf (more details), 2.8 Å
SCOPe Domain Sequences for d2hyfd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hyfd2 a.76.1.1 (D:63-138) Manganese transport regulator MntR {Bacillus subtilis [TaxId: 1423]} tskgkkigkrlvyrhelleqflriigvdeekiyndvegiehhlswnsidrigdlvqyfee ddarkkdlksiqkkte
Timeline for d2hyfd2: