Lineage for d2hyfc1 (2hyf C:2-62)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2306394Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2306994Family a.4.5.24: Iron-dependent repressor protein [46882] (4 proteins)
    automatically mapped to Pfam PF01325
  6. 2307055Protein Manganese transport regulator MntR [88986] (1 species)
  7. 2307056Species Bacillus subtilis [TaxId:1423] [88987] (11 PDB entries)
  8. 2307076Domain d2hyfc1: 2hyf C:2-62 [136884]
    Other proteins in same PDB: d2hyfa2, d2hyfb2, d2hyfc2, d2hyfd2
    automated match to d1on1a1
    complexed with epe, so4

Details for d2hyfc1

PDB Entry: 2hyf (more details), 2.8 Å

PDB Description: The Structure of apo-MntR from Bacillus subtilis, selenomethionine derivative
PDB Compounds: (C:) Transcriptional regulator mntR

SCOPe Domain Sequences for d2hyfc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hyfc1 a.4.5.24 (C:2-62) Manganese transport regulator MntR {Bacillus subtilis [TaxId: 1423]}
ttpsmedyieqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliyekyrglv
l

SCOPe Domain Coordinates for d2hyfc1:

Click to download the PDB-style file with coordinates for d2hyfc1.
(The format of our PDB-style files is described here.)

Timeline for d2hyfc1: