Lineage for d2hyed1 (2hye D:19-106)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 893809Fold g.44: RING/U-box [57849] (1 superfamily)
    dimetal(zinc)-bound alpha+beta motif; structurally diverse
  4. 893810Superfamily g.44.1: RING/U-box [57850] (6 families) (S)
  5. 893811Family g.44.1.1: RING finger domain, C3HC4 [57851] (14 proteins)
  6. 893843Protein RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex [75693] (1 species)
  7. 893844Species Human (Homo sapiens) [TaxId:9606] [75694] (6 PDB entries)
    Uniprot P62877 19-106
  8. 893850Domain d2hyed1: 2hye D:19-106 [136879]
    Other proteins in same PDB: d2hyec1, d2hyec2, d2hyec3
    automatically matched to d1ldjb_
    complexed with zn

Details for d2hyed1

PDB Entry: 2hye (more details), 3.1 Å

PDB Description: crystal structure of the ddb1-cul4a-rbx1-sv5v complex
PDB Compounds: (D:) RING-box protein 1

SCOP Domain Sequences for d2hyed1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hyed1 g.44.1.1 (D:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]}
kkrfevkkwnavalwawdivvdncaicrnhimdlciecqanqasatseectvawgvcnha
fhfhcisrwlktrqvcpldnrewefqky

SCOP Domain Coordinates for d2hyed1:

Click to download the PDB-style file with coordinates for d2hyed1.
(The format of our PDB-style files is described here.)

Timeline for d2hyed1: