SCOP 1.73: Domain d2hydb1: 2hyd B:324-578

Lineage for d2hydb1 (2hyd B:324-578)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.12: ABC transporter ATPase domain-like [52686] (20 proteins)
   there are two additional subdomains inserted into the central core that has a RecA-like topology

6. Protein Putative multidrug export ATP-binding/permease protein SAV1866 [142303] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [142304] (2 PDB entries)

8. Domain d2hydb1: 2hyd B:324-578 [136877]
   Other proteins in same PDB: d2hyda2, d2hydb2
   automatically matched to 2HYD A:324-578
   complexed with adp, na

Details for d2hydb1

PDB Entry: 2hyd, 3 Å

PDB Description: Multidrug ABC transporter SAV1866

PDB Compounds: (B:) ABC transporter homolog

SCOP Domain Sequences for d2hydb1:

Sequence; same for both SEQRES and ATOM records:

>d2hydb1 c.37.1.12 (B:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]}
ikngvgaqpieikqgrididhvsfqyndneapilkdinlsiekgetvafvgmsgggkstl
inliprfydvtsgqilidghnikdfltgslrnqiglvqqdnilfsdtvkenillgrptat
deevveaakmanahdfimnlpqgydtevgergvklsggqkqrlsiariflnnppililde
atsaldlesesiiqealdvlskdrttlivahrlstithadkivvienghivetgthreli
akqgayehlysiqnl

Timeline for d2hydb1:

• d2hydb1 is new in SCOP 1.73
  
• d2hydb1 appears in SCOP 1.75
  
• d2hydb1 appears in the current release, SCOPe 2.08