| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins) there are two additional subdomains inserted into the central core that has a RecA-like topology |
| Protein Putative multidrug export ATP-binding/permease protein SAV1866 [142303] (2 species) |
| Species Staphylococcus aureus [TaxId:1280] [142304] (2 PDB entries) Uniprot Q99T13 324-578 |
| Domain d2hyda1: 2hyd A:324-578 [136875] Other proteins in same PDB: d2hyda2, d2hydb2 complexed with adp, na |
PDB Entry: 2hyd (more details), 3 Å
SCOPe Domain Sequences for d2hyda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]}
ikngvgaqpieikqgrididhvsfqyndneapilkdinlsiekgetvafvgmsgggkstl
inliprfydvtsgqilidghnikdfltgslrnqiglvqqdnilfsdtvkenillgrptat
deevveaakmanahdfimnlpqgydtevgergvklsggqkqrlsiariflnnppililde
atsaldlesesiiqealdvlskdrttlivahrlstithadkivvienghivetgthreli
akqgayehlysiqnl
Timeline for d2hyda1: