Lineage for d2hyda1 (2hyd A:324-578)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2478252Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins)
    there are two additional subdomains inserted into the central core that has a RecA-like topology
  6. 2478496Protein Putative multidrug export ATP-binding/permease protein SAV1866 [142303] (2 species)
  7. 2478502Species Staphylococcus aureus [TaxId:1280] [142304] (2 PDB entries)
    Uniprot Q99T13 324-578
  8. 2478503Domain d2hyda1: 2hyd A:324-578 [136875]
    Other proteins in same PDB: d2hyda2, d2hydb2
    complexed with adp, na

Details for d2hyda1

PDB Entry: 2hyd (more details), 3 Å

PDB Description: Multidrug ABC transporter SAV1866
PDB Compounds: (A:) ABC transporter homolog

SCOPe Domain Sequences for d2hyda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]}
ikngvgaqpieikqgrididhvsfqyndneapilkdinlsiekgetvafvgmsgggkstl
inliprfydvtsgqilidghnikdfltgslrnqiglvqqdnilfsdtvkenillgrptat
deevveaakmanahdfimnlpqgydtevgergvklsggqkqrlsiariflnnppililde
atsaldlesesiiqealdvlskdrttlivahrlstithadkivvienghivetgthreli
akqgayehlysiqnl

SCOPe Domain Coordinates for d2hyda1:

Click to download the PDB-style file with coordinates for d2hyda1.
(The format of our PDB-style files is described here.)

Timeline for d2hyda1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hyda2