SCOPe 2.08: Domain d2hyda1: 2hyd A:324-578

Lineage for d2hyda1 (2hyd A:324-578)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins)
   there are two additional subdomains inserted into the central core that has a RecA-like topology
   missing some secondary structures that made up less than one-third of the common domain
   

6. Protein Putative multidrug export ATP-binding/permease protein SAV1866 [142303] (2 species)

7. Species Staphylococcus aureus [TaxId:1280] [142304] (2 PDB entries)
   Uniprot Q99T13 324-578

8. Domain d2hyda1: 2hyd A:324-578 [136875]
   Other proteins in same PDB: d2hyda2, d2hydb2
   complexed with adp, na

Details for d2hyda1

PDB Entry: 2hyd, 3 Å

PDB Description: Multidrug ABC transporter SAV1866

PDB Compounds: (A:) ABC transporter homolog

SCOPe Domain Sequences for d2hyda1:

Sequence; same for both SEQRES and ATOM records:

>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]}
ikngvgaqpieikqgrididhvsfqyndneapilkdinlsiekgetvafvgmsgggkstl
inliprfydvtsgqilidghnikdfltgslrnqiglvqqdnilfsdtvkenillgrptat
deevveaakmanahdfimnlpqgydtevgergvklsggqkqrlsiariflnnppililde
atsaldlesesiiqealdvlskdrttlivahrlstithadkivvienghivetgthreli
akqgayehlysiqnl

Timeline for d2hyda1:

• d2hyda1 first appeared in SCOP 1.73
  
• d2hyda1 appears in SCOPe 2.07