| Class h: Coiled coil proteins [57942] (7 folds) |
| Fold h.1: Parallel coiled-coil [57943] (35 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.3: Leucine zipper domain [57959] (1 family) ![]() |
| Family h.1.3.1: Leucine zipper domain [57960] (16 proteins) |
| Protein GCN4 [57961] (2 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57962] (64 PDB entries) Uniprot P03069 249-279 ! Uniprot P03069 249-281 |
| Domain d2hy6f_: 2hy6 F: [136873] automated match to d2hy6a1 complexed with hez |
PDB Entry: 2hy6 (more details), 1.25 Å
SCOPe Domain Sequences for d2hy6f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hy6f_ h.1.3.1 (F:) GCN4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mkvkqladaveelasanyhlanavarlakavg
Timeline for d2hy6f_: