Lineage for d2hy6f_ (2hy6 F:)

  1. Root: SCOPe 2.05
  2. 1968223Class h: Coiled coil proteins [57942] (7 folds)
  3. 1968224Fold h.1: Parallel coiled-coil [57943] (35 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 1968446Superfamily h.1.3: Leucine zipper domain [57959] (1 family) (S)
  5. 1968447Family h.1.3.1: Leucine zipper domain [57960] (16 proteins)
  6. 1968515Protein GCN4 [57961] (2 species)
  7. 1968516Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57962] (64 PDB entries)
    Uniprot P03069 249-279 ! Uniprot P03069 249-281
  8. 1968640Domain d2hy6f_: 2hy6 F: [136873]
    automated match to d2hy6a1
    complexed with hez

Details for d2hy6f_

PDB Entry: 2hy6 (more details), 1.25 Å

PDB Description: a seven-helix coiled coil
PDB Compounds: (F:) General control protein GCN4

SCOPe Domain Sequences for d2hy6f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hy6f_ h.1.3.1 (F:) GCN4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mkvkqladaveelasanyhlanavarlakavg

SCOPe Domain Coordinates for d2hy6f_:

Click to download the PDB-style file with coordinates for d2hy6f_.
(The format of our PDB-style files is described here.)

Timeline for d2hy6f_: