Lineage for d2hxza_ (2hxz A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2926589Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2926590Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2926591Family d.3.1.1: Papain-like [54002] (26 proteins)
  6. 2926699Protein (Pro)cathepsin S [82566] (1 species)
  7. 2926700Species Human (Homo sapiens) [TaxId:9606] [82567] (28 PDB entries)
  8. 2926716Domain d2hxza_: 2hxz A: [136861]
    automated match to d1ms6a_
    complexed with h7j, so4

Details for d2hxza_

PDB Entry: 2hxz (more details), 1.9 Å

PDB Description: Crystal Structure of Cathepsin S in complex with a Nonpeptidic Inhibitor (Hexagonal spacegroup)
PDB Compounds: (A:) cathepsin S

SCOPe Domain Sequences for d2hxza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hxza_ d.3.1.1 (A:) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]}
lpdsvdwrekgcvtevkyqgscgacwafsavgaleaqlklktgklvslsaqnlvdcstek
ygnkgcnggfmttafqyiidnkgidsdasypykamdqkcqydskyraatcskytelpygr
edvlkeavankgpvsvgvdarhpsfflyrsgvyyepsctqnvnhgvlvvgygdlngkeyw
lvknswghnfgeegyirmarnkgnhcgiasfpsypei

SCOPe Domain Coordinates for d2hxza_:

Click to download the PDB-style file with coordinates for d2hxza_.
(The format of our PDB-style files is described here.)

Timeline for d2hxza_: