| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) ![]() |
| Family c.71.1.2: RibD C-terminal domain-like [142701] (3 proteins) Pfam PF01872 |
| Protein Riboflavin biosynthesis protein RibD [142702] (2 species) |
| Species Thermotoga maritima [TaxId:2336] [142704] (1 PDB entry) Uniprot Q9X2E8 148-345 |
| Domain d2hxva1: 2hxv A:148-345 [136859] Other proteins in same PDB: d2hxva2 complexed with cl, gol, ndp, zn |
PDB Entry: 2hxv (more details), 1.8 Å
SCOPe Domain Sequences for d2hxva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hxva1 c.71.1.2 (A:148-345) Riboflavin biosynthesis protein RibD {Thermotoga maritima [TaxId: 2336]}
pfvalkyastldgkiadhrgdskwitdklrfkvhemrniysavlvgagtvlkdnpqltcr
lkegrnpvrvildrkgvlsgkvfrvfeenarvivfteseeaeypphvekalsdcsvesil
rnlyerdidsvlveggskvfsefldhadvvfgfystkifgkgldvfsgylsdvsvppkfk
vvnvefsdseflvemrpc
Timeline for d2hxva1: