SCOPe 2.05: Domain d2hxva1: 2hxv A:148-345

Lineage for d2hxva1 (2hxv A:148-345)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.2: RibD C-terminal domain-like [142701] (3 proteins)
   Pfam PF01872

6. Protein Riboflavin biosynthesis protein RibD [142702] (2 species)

7. Species Thermotoga maritima [TaxId:2336] [142704] (1 PDB entry)
   Uniprot Q9X2E8 148-345

8. Domain d2hxva1: 2hxv A:148-345 [136859]
   Other proteins in same PDB: d2hxva2
   complexed with cl, gol, ndp, zn

Details for d2hxva1

PDB Entry: 2hxv, 1.8 Å

PDB Description: crystal structure of a diaminohydroxyphosphoribosylaminopyrimidine deaminase/ 5-amino-6-(5-phosphoribosylamino)uracil reductase (tm1828) from thermotoga maritima at 1.80 a resolution

PDB Compounds: (A:) Diaminohydroxyphosphoribosylaminopyrimidine deaminase/ 5-amino-6-(5-phosphoribosylamino)uracil reductase

SCOPe Domain Sequences for d2hxva1:

Sequence; same for both SEQRES and ATOM records:

>d2hxva1 c.71.1.2 (A:148-345) Riboflavin biosynthesis protein RibD {Thermotoga maritima [TaxId: 2336]}
pfvalkyastldgkiadhrgdskwitdklrfkvhemrniysavlvgagtvlkdnpqltcr
lkegrnpvrvildrkgvlsgkvfrvfeenarvivfteseeaeypphvekalsdcsvesil
rnlyerdidsvlveggskvfsefldhadvvfgfystkifgkgldvfsgylsdvsvppkfk
vvnvefsdseflvemrpc

Timeline for d2hxva1:

• d2hxva1 first appeared in SCOP 1.73
  
• d2hxva1 appears in SCOPe 2.04
  
• d2hxva1 appears in SCOPe 2.06
  
• d2hxva1 appears in the current release, SCOPe 2.08