SCOPe 2.06: Domain d2hxma2: 2hxm A:85-304

Lineage for d2hxma2 (2hxm A:85-304)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families)

5. Family c.18.1.1: Uracil-DNA glycosylase [52142] (2 proteins)

6. Protein Uracil-DNA glycosylase [52143] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52144] (15 PDB entries)

8. Domain d2hxma2: 2hxm A:85-304 [136857]
   Other proteins in same PDB: d2hxma3
   automated match to d1akz__
   protein/DNA complex; complexed with 302

Details for d2hxma2

PDB Entry: 2hxm, 1.3 Å

PDB Description: Complex of UNG2 and a small Molecule synthetic Inhibitor

PDB Compounds: (A:) uracil-DNA glycosylase

SCOPe Domain Sequences for d2hxma2:

Sequence; same for both SEQRES and ATOM records:

>d2hxma2 c.18.1.1 (A:85-304) Uracil-DNA glycosylase {Human (Homo sapiens) [TaxId: 9606]}
fgeswkkhlsgefgkpyfiklmgfvaeerkhytvyppphqvftwtqmcdikdvkvvilgq
dpyhgpnqahglcfsvqrpvppppsleniykelstdiedfvhpghgdlsgwakqgvllln
avltvrahqanshkergweqftdavvswlnqnsnglvfllwgsyaqkkgsaidrkrhhvl
qtahpsplsvyrgffgcrhfsktnellqksgkkpidwkel

Timeline for d2hxma2:

• d2hxma2 first appeared in SCOP 1.73, called d2hxma1
  
• d2hxma2 was called d2hxma_ in SCOPe 2.05
  
• d2hxma2 appears in SCOPe 2.07
  
• d2hxma2 appears in the current release, SCOPe 2.08