Lineage for d2hxkc_ (2hxk C:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484063Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2484064Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2484065Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. 2484131Protein Thioredoxin [52835] (16 species)
  7. 2484275Species Human (Homo sapiens) [TaxId:9606] [52842] (30 PDB entries)
  8. 2484288Domain d2hxkc_: 2hxk C: [136855]
    automated match to d1auc__
    complexed with eoh

Details for d2hxkc_

PDB Entry: 2hxk (more details), 1.65 Å

PDB Description: Crystal structure of S-nitroso thioredoxin
PDB Compounds: (C:) thioredoxin

SCOPe Domain Sequences for d2hxkc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hxkc_ c.47.1.1 (C:) Thioredoxin {Human (Homo sapiens) [TaxId: 9606]}
mvkqiesktafqealdaagdklvvvdfsatwcgpckmikpffhslsekysnviflevdvd
dcqdvasecevkcmptfqffkkgqkvgefsgankekleatinelv

SCOPe Domain Coordinates for d2hxkc_:

Click to download the PDB-style file with coordinates for d2hxkc_.
(The format of our PDB-style files is described here.)

Timeline for d2hxkc_: