SCOP 1.73: Domain d2hxkc1: 2hxk C:1-105

Lineage for d2hxkc1 (2hxk C:1-105)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (22 families)

5. Family c.47.1.1: Thioltransferase [52834] (15 proteins)

6. Protein Thioredoxin [52835] (12 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52842] (22 PDB entries)

8. Domain d2hxkc1: 2hxk C:1-105 [136855]
   automatically matched to d1auc__
   complexed with eoh, snc

Details for d2hxkc1

PDB Entry: 2hxk, 1.65 Å

PDB Description: Crystal structure of S-nitroso thioredoxin

PDB Compounds: (C:) thioredoxin

SCOP Domain Sequences for d2hxkc1:

Sequence; same for both SEQRES and ATOM records:

>d2hxkc1 c.47.1.1 (C:1-105) Thioredoxin {Human (Homo sapiens) [TaxId: 9606]}
mvkqiesktafqealdaagdklvvvdfsatwcgpckmikpffhslsekysnviflevdvd
dcqdvasecevkcmptfqffkkgqkvgefsgankekleatinelv

Timeline for d2hxkc1:

• d2hxkc1 is new in SCOP 1.73
  
• d2hxkc1 appears in SCOP 1.75
  
• d2hxkc1 appears in the current release, SCOPe 2.08, called d2hxkc_