![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
![]() | Family c.47.1.1: Thioltransferase [52834] (16 proteins) |
![]() | Protein Thioredoxin [52835] (16 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [52842] (30 PDB entries) |
![]() | Domain d2hxkc_: 2hxk C: [136855] automated match to d1auc__ complexed with eoh |
PDB Entry: 2hxk (more details), 1.65 Å
SCOPe Domain Sequences for d2hxkc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hxkc_ c.47.1.1 (C:) Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} mvkqiesktafqealdaagdklvvvdfsatwcgpckmikpffhslsekysnviflevdvd dcqdvasecevkcmptfqffkkgqkvgefsgankekleatinelv
Timeline for d2hxkc_: