![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
![]() | Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (1 family) ![]() |
![]() | Family d.79.2.1: Tubulin, C-terminal domain [55308] (3 proteins) |
![]() | Protein Tubulin beta-subunit [55313] (2 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [64322] (7 PDB entries) Uniprot P02554 |
![]() | Domain d2hxhb2: 2hxh B:247-437 [136852] Other proteins in same PDB: d2hxha1, d2hxha2, d2hxhb1 automatically matched to d1sa0b2 complexed with adp, gdp, gtp, mg, ta1 |
PDB Entry: 2hxh (more details), 11 Å
SCOPe Domain Sequences for d2hxhb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hxhb2 d.79.2.1 (B:247-437) Tubulin beta-subunit {Cow (Bos taurus) [TaxId: 9913]} qlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdaknmmaacd prhgryltvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkms atfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyqq yqd
Timeline for d2hxhb2: