Lineage for d2hxhb1 (2hxh B:2-246)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1162186Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1162187Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (1 family) (S)
  5. 1162188Family c.32.1.1: Tubulin, GTPase domain [52491] (3 proteins)
  6. 1162244Protein Tubulin beta-subunit [52496] (2 species)
  7. 1162255Species Pig (Sus scrofa) [TaxId:9823] [52497] (3 PDB entries)
  8. 1162258Domain d2hxhb1: 2hxh B:2-246 [136851]
    Other proteins in same PDB: d2hxha1, d2hxha2, d2hxhb2
    automatically matched to d1tvkb1
    complexed with adp, gdp, gtp, mg, ta1

Details for d2hxhb1

PDB Entry: 2hxh (more details), 11 Å

PDB Description: kif1a head-microtubule complex structure in adp-form
PDB Compounds: (B:) Tubulin beta chain

SCOPe Domain Sequences for d2hxhb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hxhb1 c.32.1.1 (B:2-246) Tubulin beta-subunit {Pig (Sus scrofa) [TaxId: 9823]}
reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneaagnkyvp
railvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvr
kesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvvpspkvsdtvve
pynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttclr
fpg

SCOPe Domain Coordinates for d2hxhb1:

Click to download the PDB-style file with coordinates for d2hxhb1.
(The format of our PDB-style files is described here.)

Timeline for d2hxhb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hxhb2