| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (1 family) ![]() |
| Family d.79.2.1: Tubulin, C-terminal domain [55308] (3 proteins) |
| Protein Tubulin alpha-subunit [55311] (3 species) |
| Species Pig (Sus scrofa) [TaxId:9823] [55312] (3 PDB entries) |
| Domain d2hxha2: 2hxh A:246-439 [136850] Other proteins in same PDB: d2hxha1, d2hxhb1, d2hxhb2 automatically matched to d1tuba2 complexed with adp, gdp, gtp, mg, ta1 |
PDB Entry: 2hxh (more details), 11 Å
SCOPe Domain Sequences for d2hxha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hxha2 d.79.2.1 (A:246-439) Tubulin alpha-subunit {Pig (Sus scrofa) [TaxId: 9823]}
galnvdltefqtnlvpyprahfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrtiqfvdwcptgfkvginyepptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvds
Timeline for d2hxha2: