Lineage for d2hxha1 (2hxh A:2-245)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 828655Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 828656Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (1 family) (S)
  5. 828657Family c.32.1.1: Tubulin, GTPase domain [52491] (3 proteins)
  6. 828696Protein Tubulin alpha-subunit [52494] (3 species)
  7. 828705Species Pig (Sus scrofa) [TaxId:9823] [52495] (3 PDB entries)
  8. 828708Domain d2hxha1: 2hxh A:2-245 [136849]
    Other proteins in same PDB: d2hxha2, d2hxhb1, d2hxhb2
    automatically matched to d1tuba1
    complexed with adp, gdp, gtp, mg, ta1; mutant

Details for d2hxha1

PDB Entry: 2hxh (more details), 11 Å

PDB Description: kif1a head-microtubule complex structure in adp-form
PDB Compounds: (A:) Tubulin alpha chain

SCOP Domain Sequences for d2hxha1:

Sequence, based on SEQRES records: (download)

>d2hxha1 c.32.1.1 (A:2-245) Tubulin alpha-subunit {Pig (Sus scrofa) [TaxId: 9823]}
recisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagkh
vpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvldr
irkladqctglqgfsvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvstav
vepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrligqivssitas
lrfd

Sequence, based on observed residues (ATOM records): (download)

>d2hxha1 c.32.1.1 (A:2-245) Tubulin alpha-subunit {Pig (Sus scrofa) [TaxId: 9823]}
recisihvgqagvqignacwelyclehgiqpdghvpravfvdleptvidevrtgtyrqlf
hpeqlitgkedaannyarghytigkeiidlvldrirkladqctglqgfsvfhsfgggtgs
gftsllmerlsvdygkksklefsiypapqvstavvepynsiltthttlehsdcafmvdne
aiydicrrnldierptytnlnrligqivssitaslrfd

SCOP Domain Coordinates for d2hxha1:

Click to download the PDB-style file with coordinates for d2hxha1.
(The format of our PDB-style files is described here.)

Timeline for d2hxha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hxha2