SCOP 1.73: Domain d2hxgc1: 2hxg C:329-498

Lineage for d2hxgc1 (2hxg C:329-498)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.2: FucI/AraA C-terminal domain-like [50443] (2 families)

5. Family b.43.2.2: AraA C-terminal domain-like [141331] (1 protein)
   C-terminal part of Pfam PF02610

6. Protein L-arabinose isomerase AraA [141332] (1 species)

7. Species Escherichia coli [TaxId:562] [141333] (2 PDB entries)

8. Domain d2hxgc1: 2hxg C:329-498 [136847]
   Other proteins in same PDB: d2hxga2, d2hxgb2, d2hxgc2
   automatically matched to 2AJT A:329-498
   complexed with mn

Details for d2hxgc1

PDB Entry: 2hxg, 2.8 Å

PDB Description: crystal structure of mn2+ bound ecai

PDB Compounds: (C:) L-arabinose isomerase

SCOP Domain Sequences for d2hxgc1:

Sequence; same for both SEQRES and ATOM records:

>d2hxgc1 b.43.2.2 (C:329-498) L-arabinose isomerase AraA {Escherichia coli [TaxId: 562]}
tsfmedytyhfekgndlvlgshmlevcpsiaveekpildvqhlgiggkddparlifntqt
gpaivaslidlgdryrllvncidtvktphslpklpvanalwkaqpdlptaseawilagga
hhtvfshalnlndmrqfaemhdieitvidndtrlpafkdalrwnevyygf

Timeline for d2hxgc1:

• d2hxgc1 is new in SCOP 1.73
  
• d2hxgc1 appears in SCOP 1.75
  
• d2hxgc1 appears in the current release, SCOPe 2.08