Lineage for d2hxga1 (2hxg A:329-498)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 669479Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 669480Superfamily b.43.2: FucI/AraA C-terminal domain-like [50443] (2 families) (S)
  5. 669490Family b.43.2.2: AraA C-terminal domain-like [141331] (1 protein)
    C-terminal part of Pfam PF02610
  6. 669491Protein L-arabinose isomerase AraA [141332] (1 species)
  7. 669492Species Escherichia coli [TaxId:562] [141333] (2 PDB entries)
  8. 669496Domain d2hxga1: 2hxg A:329-498 [136843]
    Other proteins in same PDB: d2hxga2, d2hxgb2, d2hxgc2
    automatically matched to 2AJT A:329-498
    complexed with mn

Details for d2hxga1

PDB Entry: 2hxg (more details), 2.8 Å

PDB Description: crystal structure of mn2+ bound ecai
PDB Compounds: (A:) L-arabinose isomerase

SCOP Domain Sequences for d2hxga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hxga1 b.43.2.2 (A:329-498) L-arabinose isomerase AraA {Escherichia coli [TaxId: 562]}
tsfmedytyhfekgndlvlgshmlevcpsiaveekpildvqhlgiggkddparlifntqt
gpaivaslidlgdryrllvncidtvktphslpklpvanalwkaqpdlptaseawilagga
hhtvfshalnlndmrqfaemhdieitvidndtrlpafkdalrwnevyygf

SCOP Domain Coordinates for d2hxga1:

Click to download the PDB-style file with coordinates for d2hxga1.
(The format of our PDB-style files is described here.)

Timeline for d2hxga1: