Lineage for d2hxfc1 (2hxf C:3-361)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 695085Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 695086Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 696444Family c.37.1.9: Motor proteins [52641] (4 proteins)
  6. 696445Protein Kinesin [52646] (7 species)
  7. 696482Species Mouse (Mus musculus), kif1a [TaxId:10090] [64017] (7 PDB entries)
  8. 696489Domain d2hxfc1: 2hxf C:3-361 [136842]
    Other proteins in same PDB: d2hxfa1, d2hxfa2, d2hxfb1, d2hxfb2
    automatically matched to d1i6ia_
    complexed with anp, gdp, gtp, mg, ta1; mutant

Details for d2hxfc1

PDB Entry: 2hxf (more details)

PDB Description: KIF1A head-microtubule complex structure in amppnp-form
PDB Compounds: (C:) Kinesin-like protein KIF1A

SCOP Domain Sequences for d2hxfc1:

Sequence, based on SEQRES records: (download)

>d2hxfc1 c.37.1.9 (C:3-361) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]}
gasvkvavrvrpfnsremsrdskciiqmsgstttivnpkqpketpksfsfdysywshtsp
edinyasqkqvyrdigeemlqhafegynvcifaygqtgagksytmmgkqekdqqgiipql
cedlfsrindttndnmsysvevsymeiycervrdllnpknkgnlrvrehpllgpyvedls
klavtsyndiqdlmdsgnkartvaatnmnetssrshavfniiftqkrhdaetnittekvs
kislvdlagseradstgakgtrlkeganinkslttlgkvisalaemdsgpnknkkkkktd
fipyrdsvltwllrenlggnsrtamvaalspadinydetlstlryadrakqirntvsvn

Sequence, based on observed residues (ATOM records): (download)

>d2hxfc1 c.37.1.9 (C:3-361) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]}
gasvkvavrvrpfnsremsrdskciiqmsgstttivnpkqpketpksfsfdysywshtsp
edinyasqkqvyrdigeemlqhafegynvcifaygqtgagksytmmgkqekdqqgiipql
cedlfsrindttndnmsysvevsymeiycervrdllnpknkgnlrvrehpllgpyvedls
klavtsyndiqdlmdsgnkartvtssrshavfniiftqkrhdaetnittekvskislvdl
agseaninkslttlgkvisalaemfipyrdsvltwllrenlggnsrtamvaalspadiny
detlstlryadrakqirntvsvn

SCOP Domain Coordinates for d2hxfc1:

Click to download the PDB-style file with coordinates for d2hxfc1.
(The format of our PDB-style files is described here.)

Timeline for d2hxfc1: