![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
![]() | Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) ![]() |
![]() | Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
![]() | Protein Tubulin beta-subunit [55313] (2 species) |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [55314] (8 PDB entries) |
![]() | Domain d2hxfb2: 2hxf B:247-437 [136841] Other proteins in same PDB: d2hxfa1, d2hxfa2, d2hxfb1, d2hxfc1 automatically matched to d1sa0b2 complexed with anp, gdp, gtp, mg, ta1 |
PDB Entry: 2hxf (more details), 10 Å
SCOPe Domain Sequences for d2hxfb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hxfb2 d.79.2.1 (B:247-437) Tubulin beta-subunit {Pig (Sus scrofa) [TaxId: 9823]} qlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdaknmmaacd prhgryltvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkms atfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyqq yqd
Timeline for d2hxfb2: