SCOPe 2.04: Domain d2hxfb2: 2hxf B:247-437

Lineage for d2hxfb2 (2hxf B:247-437)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)

6. Protein Tubulin beta-subunit [55313] (2 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [55314] (3 PDB entries)

8. Domain d2hxfb2: 2hxf B:247-437 [136841]
   Other proteins in same PDB: d2hxfa1, d2hxfa2, d2hxfb1, d2hxfc1
   automatically matched to d1sa0b2
   complexed with anp, gdp, gtp, mg, ta1

Details for d2hxfb2

PDB Entry: 2hxf, 10 Å

PDB Description: kif1a head-microtubule complex structure in amppnp-form

PDB Compounds: (B:) Tubulin beta chain

SCOPe Domain Sequences for d2hxfb2:

Sequence; same for both SEQRES and ATOM records:

>d2hxfb2 d.79.2.1 (B:247-437) Tubulin beta-subunit {Pig (Sus scrofa) [TaxId: 9823]}
qlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdaknmmaacd
prhgryltvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkms
atfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyqq
yqd

Timeline for d2hxfb2:

• d2hxfb2 first appeared in SCOP 1.73
  
• d2hxfb2 appears in SCOPe 2.03
  
• d2hxfb2 appears in SCOPe 2.05
  
• d2hxfb2 appears in the current release, SCOPe 2.08