Lineage for d2hxfb1 (2hxf B:2-246)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2121563Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2121564Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2121565Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 2121663Protein Tubulin beta-subunit [52496] (2 species)
  7. 2121686Species Pig (Sus scrofa) [TaxId:9823] [52497] (3 PDB entries)
  8. 2121688Domain d2hxfb1: 2hxf B:2-246 [136840]
    Other proteins in same PDB: d2hxfa1, d2hxfa2, d2hxfb2, d2hxfc1
    automatically matched to d1tvkb1
    complexed with anp, gdp, gtp, mg, ta1

Details for d2hxfb1

PDB Entry: 2hxf (more details), 10 Å

PDB Description: kif1a head-microtubule complex structure in amppnp-form
PDB Compounds: (B:) Tubulin beta chain

SCOPe Domain Sequences for d2hxfb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hxfb1 c.32.1.1 (B:2-246) Tubulin beta-subunit {Pig (Sus scrofa) [TaxId: 9823]}
reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneaagnkyvp
railvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvr
kesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvvpspkvsdtvve
pynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttclr
fpg

SCOPe Domain Coordinates for d2hxfb1:

Click to download the PDB-style file with coordinates for d2hxfb1.
(The format of our PDB-style files is described here.)

Timeline for d2hxfb1: