![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (1 family) ![]() |
![]() | Family c.32.1.1: Tubulin, GTPase domain [52491] (3 proteins) |
![]() | Protein Tubulin beta-subunit [52496] (2 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [63990] (7 PDB entries) Uniprot P02550 ! Uniprot P02554 |
![]() | Domain d2hxfb1: 2hxf B:2-246 [136840] Other proteins in same PDB: d2hxfa1, d2hxfa2, d2hxfb2, d2hxfc1 automatically matched to d1tvkb1 complexed with anp, gdp, gtp, mg, ta1 |
PDB Entry: 2hxf (more details), 10 Å
SCOPe Domain Sequences for d2hxfb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hxfb1 c.32.1.1 (B:2-246) Tubulin beta-subunit {Cow (Bos taurus) [TaxId: 9913]} reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneaagnkyvp railvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvr kesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvvpspkvsdtvve pynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttclr fpg
Timeline for d2hxfb1: