Lineage for d2hxfb1 (2hxf B:2-246)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 694479Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 694480Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (1 family) (S)
  5. 694481Family c.32.1.1: Tubulin, GTPase domain [52491] (3 protein domains)
  6. 694525Protein Tubulin beta-subunit [52496] (2 species)
  7. 694526Species Cow (Bos taurus) [TaxId:9913] [63990] (6 PDB entries)
  8. 694534Domain d2hxfb1: 2hxf B:2-246 [136840]
    Other proteins in same PDB: d2hxfa1, d2hxfa2, d2hxfb2, d2hxfc1
    automatically matched to d1tvkb1
    complexed with anp, gdp, gtp, mg, ta1; mutant

Details for d2hxfb1

PDB Entry: 2hxf (more details)

PDB Description: KIF1A head-microtubule complex structure in amppnp-form
PDB Compounds: (B:) Tubulin beta chain

SCOP Domain Sequences for d2hxfb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hxfb1 c.32.1.1 (B:2-246) Tubulin beta-subunit {Cow (Bos taurus) [TaxId: 9913]}
reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneaagnkyvp
railvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvr
kesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvvpspkvsdtvve
pynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttclr
fpg

SCOP Domain Coordinates for d2hxfb1:

Click to download the PDB-style file with coordinates for d2hxfb1.
(The format of our PDB-style files is described here.)

Timeline for d2hxfb1: