SCOPe 2.08: Domain d2hxfb1: 2hxf B:2-246

Lineage for d2hxfb1 (2hxf B:2-246)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)

6. Protein Tubulin beta-subunit [52496] (2 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [52497] (9 PDB entries)

8. Domain d2hxfb1: 2hxf B:2-246 [136840]
   Other proteins in same PDB: d2hxfa1, d2hxfa2, d2hxfb2, d2hxfc1
   automatically matched to d1tvkb1
   complexed with anp, gdp, gtp, mg, ta1

Details for d2hxfb1

PDB Entry: 2hxf, 10 Å

PDB Description: kif1a head-microtubule complex structure in amppnp-form

PDB Compounds: (B:) Tubulin beta chain

SCOPe Domain Sequences for d2hxfb1:

Sequence; same for both SEQRES and ATOM records:

>d2hxfb1 c.32.1.1 (B:2-246) Tubulin beta-subunit {Pig (Sus scrofa) [TaxId: 9823]}
reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneaagnkyvp
railvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvr
kesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvvpspkvsdtvve
pynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttclr
fpg

Timeline for d2hxfb1:

• d2hxfb1 first appeared in SCOP 1.73
  
• d2hxfb1 appears in SCOPe 2.07