SCOP 1.75: Domain d2hxfa2: 2hxf A:246-439

Lineage for d2hxfa2 (2hxf A:246-439)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (1 family)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (3 proteins)

6. Protein Tubulin alpha-subunit [55311] (3 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [55312] (3 PDB entries)

8. Domain d2hxfa2: 2hxf A:246-439 [136839]
   Other proteins in same PDB: d2hxfa1, d2hxfb1, d2hxfb2, d2hxfc1
   automatically matched to d1tuba2
   complexed with anp, gdp, gtp, mg, ta1; mutant

Details for d2hxfa2

PDB Entry: 2hxf, 10 Å

PDB Description: kif1a head-microtubule complex structure in amppnp-form

PDB Compounds: (A:) Tubulin alpha chain

SCOP Domain Sequences for d2hxfa2:

Sequence; same for both SEQRES and ATOM records:

>d2hxfa2 d.79.2.1 (A:246-439) Tubulin alpha-subunit {Pig (Sus scrofa) [TaxId: 9823]}
galnvdltefqtnlvpyprahfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrtiqfvdwcptgfkvginyepptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvds

Timeline for d2hxfa2:

• d2hxfa2 first appeared in SCOP 1.73
  
• d2hxfa2 appears in SCOPe 2.01
  
• d2hxfa2 appears in the current release, SCOPe 2.08