Lineage for d2hxfa2 (2hxf A:246-439)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 727288Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 727435Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (1 family) (S)
  5. 727436Family d.79.2.1: Tubulin, C-terminal domain [55308] (3 proteins)
  6. 727469Protein Tubulin alpha-subunit [55311] (2 species)
  7. 727477Species Pig (Sus scrofa) [TaxId:9823] [55312] (3 PDB entries)
  8. 727479Domain d2hxfa2: 2hxf A:246-439 [136839]
    Other proteins in same PDB: d2hxfa1, d2hxfb1, d2hxfb2, d2hxfc1
    automatically matched to d1tuba2
    complexed with anp, gdp, gtp, mg, ta1; mutant

Details for d2hxfa2

PDB Entry: 2hxf (more details)

PDB Description: kif1a head-microtubule complex structure in amppnp-form
PDB Compounds: (A:) Tubulin alpha chain

SCOP Domain Sequences for d2hxfa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hxfa2 d.79.2.1 (A:246-439) Tubulin alpha-subunit {Pig (Sus scrofa) [TaxId: 9823]}
galnvdltefqtnlvpyprahfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrtiqfvdwcptgfkvginyepptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvds

SCOP Domain Coordinates for d2hxfa2:

Click to download the PDB-style file with coordinates for d2hxfa2.
(The format of our PDB-style files is described here.)

Timeline for d2hxfa2: