Lineage for d2hxfa1 (2hxf A:2-245)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2107739Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2107740Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2107741Family c.32.1.1: Tubulin, GTPase domain [52491] (4 protein domains)
  6. 2107819Protein Tubulin alpha-subunit [52494] (3 species)
  7. 2107828Species Pig (Sus scrofa) [TaxId:9823] [52495] (3 PDB entries)
  8. 2107830Domain d2hxfa1: 2hxf A:2-245 [136838]
    Other proteins in same PDB: d2hxfa2, d2hxfb1, d2hxfb2, d2hxfc1
    automatically matched to d1tuba1
    complexed with anp, gdp, gtp, mg, ta1

Details for d2hxfa1

PDB Entry: 2hxf (more details), 10 Å

PDB Description: KIF1A head-microtubule complex structure in amppnp-form
PDB Compounds: (A:) Tubulin alpha chain

SCOPe Domain Sequences for d2hxfa1:

Sequence, based on SEQRES records: (download)

>d2hxfa1 c.32.1.1 (A:2-245) Tubulin alpha-subunit {Pig (Sus scrofa) [TaxId: 9823]}
recisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagkh
vpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvldr
irkladqctglqgfsvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvstav
vepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrligqivssitas
lrfd

Sequence, based on observed residues (ATOM records): (download)

>d2hxfa1 c.32.1.1 (A:2-245) Tubulin alpha-subunit {Pig (Sus scrofa) [TaxId: 9823]}
recisihvgqagvqignacwelyclehgiqpdghvpravfvdleptvidevrtgtyrqlf
hpeqlitgkedaannyarghytigkeiidlvldrirkladqctglqgfsvfhsfgggtgs
gftsllmerlsvdygkksklefsiypapqvstavvepynsiltthttlehsdcafmvdne
aiydicrrnldierptytnlnrligqivssitaslrfd

SCOPe Domain Coordinates for d2hxfa1:

Click to download the PDB-style file with coordinates for d2hxfa1.
(The format of our PDB-style files is described here.)

Timeline for d2hxfa1: