Lineage for d2hx5a1 (2hx5 A:1-144)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943538Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2943539Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. 2943540Family d.38.1.1: 4HBT-like [54638] (19 proteins)
    Pfam PF03061
  6. 2943579Protein Hypothetical protein PMT2055 [143160] (1 species)
  7. 2943580Species Prochlorococcus marinus [TaxId:1219] [143161] (1 PDB entry)
    Uniprot Q7V4A7 1-144
  8. 2943581Domain d2hx5a1: 2hx5 A:1-144 [136837]
    complexed with etx

Details for d2hx5a1

PDB Entry: 2hx5 (more details), 1.5 Å

PDB Description: crystal structure of a putative thioesterase (pmt_2055) from prochlorococcus marinus str. mit 9313 at 1.50 a resolution
PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d2hx5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hx5a1 d.38.1.1 (A:1-144) Hypothetical protein PMT2055 {Prochlorococcus marinus [TaxId: 1219]}
mnpenwlllrrvvrfgdtdaagvmhfhqlfrwchesweeslesyglnpadifpgsrksev
tpevalpiihcqadfrrpihtgdalamelrperlnpnsfqvhfefrceeqiaahalirhl
ainaqtrhrcalpegidrwleasg

SCOPe Domain Coordinates for d2hx5a1:

Click to download the PDB-style file with coordinates for d2hx5a1.
(The format of our PDB-style files is described here.)

Timeline for d2hx5a1: