![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
![]() | Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) ![]() |
![]() | Family d.38.1.1: 4HBT-like [54638] (19 proteins) Pfam PF03061 |
![]() | Protein Hypothetical protein PMT2055 [143160] (1 species) |
![]() | Species Prochlorococcus marinus [TaxId:1219] [143161] (1 PDB entry) Uniprot Q7V4A7 1-144 |
![]() | Domain d2hx5a1: 2hx5 A:1-144 [136837] complexed with etx |
PDB Entry: 2hx5 (more details), 1.5 Å
SCOPe Domain Sequences for d2hx5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hx5a1 d.38.1.1 (A:1-144) Hypothetical protein PMT2055 {Prochlorococcus marinus [TaxId: 1219]} mnpenwlllrrvvrfgdtdaagvmhfhqlfrwchesweeslesyglnpadifpgsrksev tpevalpiihcqadfrrpihtgdalamelrperlnpnsfqvhfefrceeqiaahalirhl ainaqtrhrcalpegidrwleasg
Timeline for d2hx5a1: